PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG124100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB_related
Protein Properties Length: 1748aa    MW: 188777 Da    PI: 6.6034
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG124100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding301.2e-09861903347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+eE e++ +  +++G++ +++I++ +  ++t  +c+++++k+
  Pavir.3KG124100.1.p 861 PWTQEEKEIFMEMLAKFGKD-FSKISSFLM-HKTTADCVEFYYKH 903
                          8*****************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.09E-14846906IPR009057Homeodomain-like
PROSITE profilePS5129315.477857908IPR017884SANT domain
SMARTSM007171.8E-9858906IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-7859905IPR009057Homeodomain-like
PfamPF002491.7E-7860903IPR001005SANT/Myb domain
PROSITE profilePS5129312.20410651116IPR017884SANT domain
SMARTSM007171.3E-410661114IPR001005SANT/Myb domain
SuperFamilySSF466891.4E-810691116IPR009057Homeodomain-like
CDDcd001670.0029710701108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1748 aa     Download sequence    Send to blast
MPPPPPDRRD FLYREGRRHD GGGGGDPLLP PAPTPPRWRD SPYHPPPPPP PLRDHSRPSP  60
RRAPQSGSSG RPAPLKSSDL RRPPPRWPSS APLISPNRSA ISEGYYRQGG GAYDRSCPDE  120
PPIGYTPSRS DRYWTEDDGG GYKGFGRYGG GGGGRRDGRD MRGSYRRSPF RGYGSDFSRN  180
HPEQPPPPPP RRSPLRSVAV PICYDPPGNR VDRGDRDNLP RVTPWRRRES RSEVAGAAGA  240
GPGPVSVGQT TRPAPSEKEA SAQPLAGAAP HGADEEAPRK KARLGWGQGL AKYEKQKVQV  300
PADLAEAVAD GSPADTEQKT AFPVPPPEPP AAPAPPPEPP AAPAPPPPPE PPAEPAPEPP  360
APASVPPAAP APAPAAVCVP APVSAPSPAP CISPVDAPSS AAPFCTPAPE DKSCEQTANM  420
VINPTKDVPE AGDKTFSNEF SIKLDQLADD PINSIANMLA DLLQHDDSCS GDSKGQTSAS  480
KLLLLKESIS KEIEKTELEI DLMEGELKSV STKAGTAVEG SPTGVTYAEN ISPSSGTSKV  540
PLSVEISETS HVMKEPGELI SSPKPPVVQD VDAKGSDMME IENAAVCNAK TVSSEESAVS  600
PVVAEDLACA AADLSPLKAS EGSGFQIDMH NDRVETSPCH DNADSIKTEV SDDPPVRQCS  660
HHDHKYSLIG SVTSANNNIA KVMNESLFKS LPADTLRLDL VASSHLLSQR KNDHHIKERL  720
GVFKNRLRLK EQILTLKFKA YRHLWKEDLR LLSAKKQCSK SNKRTDQSNR ASHIGSQRQR  780
SSNRSRLSMP AGNLSTFLTP EMSDVASKLF SEFQIKRCRN YLKMPALIID EREKECLRFA  840
SKNSLVDDPV LVEKERVMIN PWTQEEKEIF MEMLAKFGKD FSKISSFLMH KTTADCVEFY  900
YKHHKSDSFR EVKKLLDLRQ HQPAGNFLGA KSGKKWNPEA NAASLDMLGV ASVVAAHDLE  960
YANRVEKVSA KSLIRAYGSN VSFAAKKSSD RECINNVPLN ERESVAADVL AGICGTLSPE  1020
GMGSCITSSA DLGKINMTRM EHILAPEFDR SIDDEDLLSD HECEVDPVDW NDNEKSIFIE  1080
AMNNYGKDFA RISSCVKSKS YEQCKVFFSK ARKSLGLDLI HQGAVDVSMP TSDTNGGRSD  1140
TDEACAAEMD SAICSTQSCS KIEMDVCPTE KGMGDIVTKQ PELNISNGFD VMNGKTGDDK  1200
EKADKNCGIV DHERFVEGTH QAACGPIDIN CPERTEKLHG KDDVVDQVNM HNNSAISSST  1260
EQAKAMHSEV RSCLHSVEVL HQSSKAPLET GTDASRMEEC SNNGLDNNLM KAENSGASSC  1320
IASDTCIRDN VHFANMTGAS TISPTFASSY KHSVSADVPQ TKPKPKPLVT PLTPKDLMPV  1380
QFSSAIPDPT AICFDGIASI TMPNFEDSGN RVSSSLGPKD MSKYPAFKDP TGNQHVTLFR  1440
NGDGYTNCLT TELPIFSERP ASATVGTSQT DRFTLTKFQN GRSSTLGLPN TSDGIQWARK  1500
HEEVLQGSLR LCSHNTSSDG DEQQKRHGDV KLFGKILSHQ SSLQSPVSSC NGNKSKPPSP  1560
KVDMSSVRLS NNPRDRVVCS SKPGITHLGL EERTVRSYGH LDASTTQPEP LLMMAKCQSL  1620
AGVPFYSAKN GTVGVFSDYQ QPSIQPHQSD PKRLERFSDA QKRNGMEFIS GFQQPGKISR  1680
FGGAGILVSG VSDPVAALKA QYGPSSKVMG SDVDPWKDIG SSSIPFASLT CQQWHSAVGS  1740
LEVLSTG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C1e-13819910494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D1e-13819910494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.32510.0callus| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960366.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_004960367.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_012700232.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
TrEMBLK3Z3350.0K3Z335_SETIT; Uncharacterized protein
STRINGSi020953m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.13e-82MYB family protein